PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002618G0290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 445aa    MW: 48549 Da    PI: 7.2041
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002618G0290genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.7e-25119163145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgrsrsrk++e+
  PH01002618G0290 119 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRSRSRKPVET 163
                      79****************************************997 PP

2QLQ60.64.3e-215893237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FTaaQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  PH01002618G0290 58 PFTAAQYEELEQQALIYKYLVAGVPVPPDLVLPIRR 93
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.1E-115793IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.8E-155892IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8795893IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.709119163IPR014977WRC domain
PfamPF088798.5E-21120162IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MAMPYASLSP AADHRSSPAA ATASLPFRRS SPLSAGNGGG GLAEDAHMNG RWAARPAPFT  60
AAQYEELEQQ ALIYKYLVAG VPVPPDLVLP IRRGIDSLAA RFYNHPALGY GSYFGKRLDP  120
EPGRCRRTDG KKWRCSKEAA PDSKYCERHM HRGRSRSRKP VETQLVPQSQ PPRRPSPPPP  180
PTAATSRTIP FTQPLPEAMV VVEAGAPTCS APSPRRWGLL SCTWTMLPLM QLLVVEQAKI  240
SDNNLAPVNY FVSEELLPVT TIPDTSEVAS MMLEAPLFSP IPMIPFYHCK SLDLASLNLL  300
LYAAYGIRSL ADEHSQLITE AINTSIENPW RLLPSQNSSF PLSSYPQLGA LSDLGQNTVN  360
SLPKVERQPL SFFGTDFGTV DSVKHENQTL RPFFDEWPKA RDSWSDLADE NANLASFSAT  420
QLSISIPMAS SDFSVASSRS PNGD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639831e-143AK063983.1 Oryza sativa Japonica Group cDNA clone:001-124-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647745.16e-99PREDICTED: LOW QUALITY PROTEIN: growth-regulating factor 4-like
SwissprotQ6ZIK54e-96GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLA0A0E0K4141e-100A0A0E0K414_ORYPU; Uncharacterized protein
STRINGSi017449m5e-94(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-48growth-regulating factor 5